PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00114555001
Common NameGSBRNA2T00114555001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 298aa    MW: 33886.2 Da    PI: 6.695
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00114555001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57385.47.7e-2786177297
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                           f r++se+DeivlLqG+id + +   +p +    fy+ +k+s sf+v+  q+ +Kir+LK+K+k k+k   ++ + s s++h+qk+f+l
  GSBRNA2T00114555001  86 SFARVFSEKDEIVLLQGVIDSQVE---NPLKYKRSFYQSMKGSFSFDVTLVQFKDKIRNLKRKYKAKEKS-GEQASASASNPHQQKCFQL 171
                          689*****************9555...5777889*********************************999.66777899*********** PP

               DUF573  92 skkiWg 97 
                          sk iWg
  GSBRNA2T00114555001 172 SKAIWG 177
                          *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045047.4E-2587177IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MANNLKHPFE DPPSSSAGEE EIESEEEDQQ HLHTIFSSEE DEPEDPPPRS VSKKRLSTNV  60
SNSTNVAKKI YRQGGKMGTT NNNTPSFARV FSEKDEIVLL QGVIDSQVEN PLKYKRSFYQ  120
SMKGSFSFDV TLVQFKDKIR NLKRKYKAKE KSGEQASASA SNPHQQKCFQ LSKAIWGVDG  180
IAVESKESER GLTKKRDLVT PRMGKREDME KSPLVEKEST DWDDESSFFL GMDFLKEKWT  240
KLPAESKKGT QEKMKKLHAN ELECQKYEEM LKVMKDKCAR DKVELLNEVT SLIMAAD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00114555001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009139700.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A078CCM40.0A0A078CCM4_BRANA; BnaA04g07920D protein
STRINGBra028108.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13542721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66420.13e-38DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]